SCOPe 2.08: Domain d4pfya1: 4pfy A:21-557

Lineage for d4pfya1 (4pfy A:21-557)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Thermotoga maritima [TaxId:2336] [142800] (3 PDB entries)
   Uniprot Q9X0V0 23-557
   TM1223

8. Domain d4pfya1: 4pfy A:21-557 [259920]
   Other proteins in same PDB: d4pfya2, d4pfyb2
   automated match to d1vr5a1
   complexed with mg, no3
   has additional subdomain(s) that are not in the common domain

Details for d4pfya1

PDB Entry: 4pfy, 1.5 Å

PDB Description: crystal structure of mannohexaose bound oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1223) from thermotoga maritima at 1.5 a resolution

PDB Compounds: (A:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4pfya1:

Sequence; same for both SEQRES and ATOM records:

>d4pfya1 c.94.1.1 (A:21-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]}
tfernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekge
wvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdert
lkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrc
vfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkay
givtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaan
pagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklt
iecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsa
tiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseil
lkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak

Timeline for d4pfya1:

• d4pfya1 first appeared in SCOPe 2.04, called d4pfya_
  
• d4pfya1 appears in SCOPe 2.07