Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries) |
Domain d3tgje_: 3tgj E: [25992] Other proteins in same PDB: d3tgji_ complexed with ca, so4 |
PDB Entry: 3tgj (more details), 2.2 Å
SCOPe Domain Sequences for d3tgje_:
Sequence, based on SEQRES records: (download)
>d3tgje_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]} kivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvle gneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclis gwgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdagg pvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
>d3tgje_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]} kivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvle gneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclis gwgpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggpvvcngelq givswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d3tgje_: