Lineage for d4pfyb_ (4pfy B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1625644Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 1625681Species Thermotoga maritima [TaxId:2336] [142800] (3 PDB entries)
    Uniprot Q9X0V0 23-557
    TM1223
  8. 1625685Domain d4pfyb_: 4pfy B: [259919]
    automated match to d1vr5a1
    complexed with mg, no3

Details for d4pfyb_

PDB Entry: 4pfy (more details), 1.5 Å

PDB Description: crystal structure of mannohexaose bound oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1223) from thermotoga maritima at 1.5 a resolution
PDB Compounds: (B:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4pfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfyb_ c.94.1.1 (B:) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]}
fernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgew
vsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertl
kfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcv
fkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkayg
ivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanp
agilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklti
ecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsat
iwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseill
kdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieakh

SCOPe Domain Coordinates for d4pfyb_:

Click to download the PDB-style file with coordinates for d4pfyb_.
(The format of our PDB-style files is described here.)

Timeline for d4pfyb_: