Lineage for d4pfua_ (4pfu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879927Protein automated matches [190140] (18 species)
    not a true protein
  7. 1880087Species Thermotoga maritima [TaxId:243274] [259690] (2 PDB entries)
  8. 1880088Domain d4pfua_: 4pfu A: [259918]
    automated match to d1vr5a1
    complexed with mab, mg, so4

Details for d4pfua_

PDB Entry: 4pfu (more details), 2.05 Å

PDB Description: crystal structure of mannobiose bound oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.05 a resolution
PDB Compounds: (A:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4pfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfua_ c.94.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
vlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekge
wldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnrt
vifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnkm
iferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkvy
nlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlkad
plgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpiklt
iecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgiss
tpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklge
illkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpak

SCOPe Domain Coordinates for d4pfua_:

Click to download the PDB-style file with coordinates for d4pfua_.
(The format of our PDB-style files is described here.)

Timeline for d4pfua_: