SCOPe 2.06: Domain d4pfwb_: 4pfw B:

Lineage for d4pfwb_ (4pfw B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (30 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [259690] (3 PDB entries)

8. Domain d4pfwb_: 4pfw B: [259917]
   automated match to d1vr5a1
   complexed with gol, mg, so4

Details for d4pfwb_

PDB Entry: 4pfw, 2.2 Å

PDB Description: crystal structure of mannohexaose bound oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.2 a resolution

PDB Compounds: (B:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4pfwb_:

Sequence; same for both SEQRES and ATOM records:

>d4pfwb_ c.94.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
vlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekge
wldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnrt
vifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnkm
iferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkvy
nlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlkad
plgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpiklt
iecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgiss
tpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklge
illkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpak

Timeline for d4pfwb_:

• d4pfwb_ first appeared in SCOPe 2.04
  
• d4pfwb_ appears in SCOPe 2.05
  
• d4pfwb_ appears in SCOPe 2.07
  
• d4pfwb_ appears in the current release, SCOPe 2.08