![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [232271] (5 PDB entries) |
![]() | Domain d4p7ia3: 4p7i A:215-312 [259916] Other proteins in same PDB: d4p7ia1, d4p7ia2, d4p7ib1, d4p7ib2 automated match to d1h4ra2 complexed with gol |
PDB Entry: 4p7i (more details), 2.6 Å
SCOPe Domain Sequences for d4p7ia3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p7ia3 b.55.1.0 (A:215-312) automated matches {Mouse (Mus musculus) [TaxId: 10090]} emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
Timeline for d4p7ia3: