SCOPe 2.07: Domain d4p7ia2: 4p7i A:104-214

Lineage for d4p7ia2 (4p7i A:104-214)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries)

8. Domain d4p7ia2: 4p7i A:104-214 [259915]
   Other proteins in same PDB: d4p7ia1, d4p7ia3, d4p7ib1, d4p7ib3
   automated match to d1h4ra1
   complexed with gol

Details for d4p7ia2

PDB Entry: 4p7i, 2.6 Å

PDB Description: crystal structure of the merlin ferm/dcaf1 complex

PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d4p7ia2:

Sequence; same for both SEQRES and ATOM records:

>d4p7ia2 a.11.2.0 (A:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d4p7ia2:

• d4p7ia2 first appeared in SCOPe 2.04
  
• d4p7ia2 appears in SCOPe 2.06