SCOPe 2.02: Domain d1slvb_: 1slv B:

Lineage for d1slvb_ (1slv B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)

8. Domain d1slvb_: 1slv B: [25991]
   Other proteins in same PDB: d1slva_
   complexed with act, ca, cu

Details for d1slvb_

PDB Entry: 1slv, 2.3 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; copper- bound

PDB Compounds: (B:) anionic trypsin

SCOPe Domain Sequences for d1slvb_:

Sequence, based on SEQRES records:

>d1slvb_ b.47.1.2 (B:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wghtlssgvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records):

>d1slvb_ b.47.1.2 (B:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvkvatvalpsscapagtqclisgwght
lnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelq
givswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1slvb_:

• d1slvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1slvb_ appears in SCOPe 2.01
  
• d1slvb_ appears in SCOPe 2.03
  
• d1slvb_ appears in the current release, SCOPe 2.08