![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d4p2cj1: 4p2c J:2-122 [259909] Other proteins in same PDB: d4p2ca_, d4p2cb_, d4p2cc_, d4p2cd_, d4p2ce_, d4p2cf_, d4p2cj2 automated match to d3ezjb_ |
PDB Entry: 4p2c (more details), 2.82 Å
SCOPe Domain Sequences for d4p2cj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p2cj1 b.1.1.1 (J:2-122) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs s
Timeline for d4p2cj1: