Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [187229] (7 PDB entries) |
Domain d4p2cf_: 4p2c F: [259908] Other proteins in same PDB: d4p2cj_ automated match to d2bosa_ |
PDB Entry: 4p2c (more details), 2.82 Å
SCOPe Domain Sequences for d4p2cf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p2cf_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]} adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs gfaqvkfn
Timeline for d4p2cf_: