Lineage for d4p2cf_ (4p2c F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540741Protein automated matches [190381] (4 species)
    not a true protein
  7. 1540764Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 1540823Domain d4p2cf_: 4p2c F: [259908]
    Other proteins in same PDB: d4p2cj_
    automated match to d2bosa_

Details for d4p2cf_

PDB Entry: 4p2c (more details), 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody
PDB Compounds: (F:) Shiga toxin 2e, subunit B

SCOPe Domain Sequences for d4p2cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p2cf_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaqvkfn

SCOPe Domain Coordinates for d4p2cf_:

Click to download the PDB-style file with coordinates for d4p2cf_.
(The format of our PDB-style files is described here.)

Timeline for d4p2cf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4p2cj_