SCOP 1.67: Domain d1ezsd_: 1ezs D:

Lineage for d1ezsd_ (1ezs D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1ezsd_: 1ezs D: [25990]
   Other proteins in same PDB: d1ezsa_, d1ezsb_
   complexed with ca; mutant

Details for d1ezsd_

PDB Entry: 1ezs, 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

SCOP Domain Sequences for d1ezsd_:

Sequence; same for both SEQRES and ATOM records:

>d1ezsd_ b.47.1.2 (D:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ezsd_:

• d1ezsd_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezsd_ appears in SCOP 1.65
  
• d1ezsd_ appears in SCOP 1.69
  
• d1ezsd_ appears in the current release, SCOPe 2.08