Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein Trypsin(ogen) [50515] (8 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries) |
Domain d1ezsd_: 1ezs D: [25990] Other proteins in same PDB: d1ezsa_, d1ezsb_ complexed with ca; mutant |
PDB Entry: 1ezs (more details), 2.3 Å
SCOP Domain Sequences for d1ezsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezsd_ b.47.1.2 (D:) Trypsin(ogen) {Rat (Rattus norvegicus)} ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d1ezsd_: