Lineage for d4p1cc_ (4p1c C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1895171Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1895193Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 1895194Protein automated matches [190991] (1 species)
    not a true protein
  7. 1895195Species Pseudomonas mendocina [TaxId:300] [188696] (16 PDB entries)
  8. 1895216Domain d4p1cc_: 4p1c C: [259899]
    Other proteins in same PDB: d4p1ca_, d4p1cd_, d4p1ch_, d4p1ci_
    automated match to d3ge3c_
    complexed with fe, fes, peg

Details for d4p1cc_

PDB Entry: 4p1c (more details), 2.4 Å

PDB Description: crystal structure of the toluene 4-monooxygenase hydroxylase- ferredoxin c7s, c84a, c85a variant electron-transfer complex
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d4p1cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p1cc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d4p1cc_:

Click to download the PDB-style file with coordinates for d4p1cc_.
(The format of our PDB-style files is described here.)

Timeline for d4p1cc_: