Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (14 species) not a true protein |
Species Haloferax mediterranei [TaxId:523841] [258052] (3 PDB entries) |
Domain d4oznb_: 4ozn B: [259893] automated match to d2o66a_ complexed with atp, so4 |
PDB Entry: 4ozn (more details), 2.6 Å
SCOPe Domain Sequences for d4oznb_:
Sequence, based on SEQRES records: (download)
>d4oznb_ d.58.5.0 (B:) automated matches {Haloferax mediterranei [TaxId: 523841]} dlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqpakksqwrgeeytv dlhqkvkvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav
>d4oznb_ d.58.5.0 (B:) automated matches {Haloferax mediterranei [TaxId: 523841]} dlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsdlhqkvkvecvvadt paedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav
Timeline for d4oznb_: