Lineage for d4oylb_ (4oyl B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152880Species Fungus (Humicola insolens) [TaxId:34413] [257354] (2 PDB entries)
  8. 2152882Domain d4oylb_: 4oyl B: [259891]
    automated match to d3dd5a_

Details for d4oylb_

PDB Entry: 4oyl (more details), 2.05 Å

PDB Description: humicola insolens cutinase in complex with mono-ethylphosphate
PDB Compounds: (B:) cutinase

SCOPe Domain Sequences for d4oylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oylb_ c.69.1.0 (B:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
gaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvggpy
daalatnflprgtsqanidegkrlfalanqkcpntpvvaggyxqgaaliaaavselsgav
keqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpaxlsytiearg
eaarflrdrir

SCOPe Domain Coordinates for d4oylb_:

Click to download the PDB-style file with coordinates for d4oylb_.
(The format of our PDB-style files is described here.)

Timeline for d4oylb_: