Lineage for d4oylb_ (4oyl B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871184Species Fungus (Humicola insolens) [TaxId:34413] [257354] (2 PDB entries)
  8. 1871186Domain d4oylb_: 4oyl B: [259891]
    automated match to d3dd5a_

Details for d4oylb_

PDB Entry: 4oyl (more details), 2.05 Å

PDB Description: humicola insolens cutinase in complex with mono-ethylphosphate
PDB Compounds: (B:) cutinase

SCOPe Domain Sequences for d4oylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oylb_ c.69.1.0 (B:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
gaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvggpy
daalatnflprgtsqanidegkrlfalanqkcpntpvvaggyxqgaaliaaavselsgav
keqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpaxlsytiearg
eaarflrdrir

SCOPe Domain Coordinates for d4oylb_:

Click to download the PDB-style file with coordinates for d4oylb_.
(The format of our PDB-style files is described here.)

Timeline for d4oylb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4oyla_