Lineage for d1ezsc_ (1ezs C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803036Protein Trypsin(ogen) [50515] (9 species)
  7. 803396Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)
  8. 803421Domain d1ezsc_: 1ezs C: [25989]
    Other proteins in same PDB: d1ezsa_, d1ezsb_

Details for d1ezsc_

PDB Entry: 1ezs (more details), 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
PDB Compounds: (C:) trypsin II, anionic

SCOP Domain Sequences for d1ezsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezsc_ b.47.1.2 (C:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1ezsc_:

Click to download the PDB-style file with coordinates for d1ezsc_.
(The format of our PDB-style files is described here.)

Timeline for d1ezsc_: