SCOP 1.59: Domain d1ezsc_: 1ezs C:

Lineage for d1ezsc_ (1ezs C:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)

8. Domain d1ezsc_: 1ezs C: [25989]
   Other proteins in same PDB: d1ezsa_, d1ezsb_

Details for d1ezsc_

PDB Entry: 1ezs, 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

SCOP Domain Sequences for d1ezsc_:

Sequence; same for both SEQRES and ATOM records:

>d1ezsc_ b.47.1.2 (C:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ezsc_:

• d1ezsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezsc_ appears in SCOP 1.57
  
• d1ezsc_ appears in SCOP 1.61
  
• d1ezsc_ appears in the current release, SCOPe 2.08