![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [257310] (2 PDB entries) |
![]() | Domain d4oqqa_: 4oqq A: [259877] automated match to d3nzeb_ complexed with bcn |
PDB Entry: 4oqq (more details), 1.8 Å
SCOPe Domain Sequences for d4oqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oqqa_ c.124.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} edldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswgt tmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvfd nadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqavg dicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyanv liidqhtaralvnd
Timeline for d4oqqa_: