Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries) |
Domain d4ohda1: 4ohd A:2-110 [259874] Other proteins in same PDB: d4ohda3 automated match to d2b3oa1 mutant |
PDB Entry: 4ohd (more details), 2.7 Å
SCOPe Domain Sequences for d4ohda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohda1 d.93.1.0 (A:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgd yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
Timeline for d4ohda1: