Lineage for d1trma_ (1trm A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2406157Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2406195Domain d1trma_: 1trm A: [25987]
    complexed with ben, ca; mutant

Details for d1trma_

PDB Entry: 1trm (more details), 2.3 Å

PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1trma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trma_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1trma_:

Click to download the PDB-style file with coordinates for d1trma_.
(The format of our PDB-style files is described here.)

Timeline for d1trma_: