SCOP 1.57: Domain d1trma_: 1trm A:

Lineage for d1trma_ (1trm A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)

6. Protein Trypsin(ogen) [50515] (6 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)

8. Domain d1trma_: 1trm A: [25987]

Details for d1trma_

PDB Entry: 1trm, 2.3 Å

PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis

SCOP Domain Sequences for d1trma_:

Sequence; same for both SEQRES and ATOM records:

>d1trma_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1trma_:

• d1trma_ first appeared (with stable ids) in SCOP 1.55
  
• d1trma_ appears in SCOP 1.59
  
• d1trma_ appears in the current release, SCOPe 2.08