Lineage for d1trma_ (1trm A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (21 PDB entries) 
Domain d1trma_: 1trm A: [25987]
Details for d1trma_
PDB Entry: 1trm (more details), 2.3 Å
PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
SCOP Domain Sequences for d1trma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trma_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
SCOP Domain Coordinates for d1trma_:
Click to download the PDB-style file with coordinates for d1trma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trma_:
- d1trma_ appears in SCOP 1.57
- d1trma_ appears in the current release, SCOPe 2.08
View in 3D
