![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
![]() | Protein automated matches [190561] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
![]() | Domain d4ohia1: 4ohi A:3-110 [259867] Other proteins in same PDB: d4ohia3 automated match to d2b3oa1 mutant |
PDB Entry: 4ohi (more details), 2.2 Å
SCOPe Domain Sequences for d4ohia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohia1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
Timeline for d4ohia1: