SCOPe 2.02: Domain d1ql9a_: 1ql9 A:

Lineage for d1ql9a_ (1ql9 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)

8. Domain d1ql9a_: 1ql9 A: [25986]
   complexed with ca, so4, zen; mutant

Details for d1ql9a_

PDB Entry: 1ql9, 2.3 Å

PDB Description: factor xa specific inhibitor in complex with rat trypsin mutant x99rt

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1ql9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ql9a_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ql9a_:

• d1ql9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ql9a_ appears in SCOPe 2.01
  
• d1ql9a_ appears in SCOPe 2.03
  
• d1ql9a_ appears in the current release, SCOPe 2.08