Lineage for d1ql9a_ (1ql9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2057319Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2057344Domain d1ql9a_: 1ql9 A: [25986]
    complexed with ca, so4, zen; mutant

Details for d1ql9a_

PDB Entry: 1ql9 (more details), 2.3 Å

PDB Description: factor xa specific inhibitor in complex with rat trypsin mutant x99rt
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1ql9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ql9a_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1ql9a_:

Click to download the PDB-style file with coordinates for d1ql9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ql9a_: