Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Nickel-binding periplasmic protein NikA [102694] (2 species) similar domain organization to oligo- and dipeptide-binding protein |
Species Brucella suis [TaxId:29461] [259856] (2 PDB entries) |
Domain d4oerb_: 4oer B: [259857] automated match to d1zlqb_ complexed with gol, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 4oer (more details), 1.85 Å
SCOPe Domain Sequences for d4oerb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oerb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Brucella suis [TaxId: 29461]} dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk itfgamsseipfekltpk
Timeline for d4oerb_: