SCOPe 2.08: Domain d4oerb_: 4oer B:

Lineage for d4oerb_ (4oer B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Brucella suis [TaxId:29461] [259856] (2 PDB entries)

8. Domain d4oerb_: 4oer B: [259857]
   automated match to d1zlqb_
   complexed with gol, so4
   has additional subdomain(s) that are not in the common domain

Details for d4oerb_

PDB Entry: 4oer, 1.85 Å

PDB Description: Crystal structure of NikA from Brucella suis, unliganded form

PDB Compounds: (B:) NikA protein

SCOPe Domain Sequences for d4oerb_:

Sequence; same for both SEQRES and ATOM records:

>d4oerb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Brucella suis [TaxId: 29461]}
dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs
ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl
kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd
sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel
sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan
iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa
dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq
lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk
itfgamsseipfekltpk

Timeline for d4oerb_:

• d4oerb_ first appeared in SCOPe 2.04
  
• d4oerb_ appears in SCOPe 2.07