SCOPe 2.07: Domain d4oeta_: 4oet A:

Lineage for d4oeta_ (4oet A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [259851] (3 PDB entries)

8. Domain d4oeta_: 4oet A: [259854]
   automated match to d1xoca1
   complexed with gol

Details for d4oeta_

PDB Entry: 4oet, 2.4 Å

PDB Description: crystal structure of nikz from campylobacter jejuni, unliganded form

PDB Compounds: (A:) Putative peptide ABC-transport system periplasmic peptide-binding protein

SCOPe Domain Sequences for d4oeta_:

Sequence; same for both SEQRES and ATOM records:

>d4oeta_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kipkdtliiaveneiarinpaysedhdavinlvfsgltrfdenmslkpdlakswdiskdg
lvydiflrddvlwhdgvkfsaddvkfsieafknpknnssiyvnfediksveilnpshvki
tlfkpypafldalsigmlpkhllenenlntssfnqnpigtgpykfvkwkkgeyvefkane
hfyldkvktprliikhifdpsiasaelkngkidaalidvsllnifkndenfgilreksad
yralmfnldneflkdlkvrqalnyavdkesivknllhdyafvanhplerswansknfkiy
kydpkkaedllvsagfkknkdgnfekdgkilefeiwamsndplrvslagilqsefrkigv
vskvvakpagsfdyskvdsfligwgspldpdfhtfrvfessqdsalndegwnfghyhdkk
vdialqkarntsnleerkkyykdfidalyenppfiflayldfalvynkdlkgiktrtlgh
hgvgftwnvyewsk

Timeline for d4oeta_:

• d4oeta_ first appeared in SCOPe 2.04
  
• d4oeta_ appears in SCOPe 2.06
  
• d4oeta_ appears in the current release, SCOPe 2.08