Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [259851] (3 PDB entries) |
Domain d4oeta_: 4oet A: [259854] automated match to d1xoca1 complexed with gol |
PDB Entry: 4oet (more details), 2.4 Å
SCOPe Domain Sequences for d4oeta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oeta_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]} kipkdtliiaveneiarinpaysedhdavinlvfsgltrfdenmslkpdlakswdiskdg lvydiflrddvlwhdgvkfsaddvkfsieafknpknnssiyvnfediksveilnpshvki tlfkpypafldalsigmlpkhllenenlntssfnqnpigtgpykfvkwkkgeyvefkane hfyldkvktprliikhifdpsiasaelkngkidaalidvsllnifkndenfgilreksad yralmfnldneflkdlkvrqalnyavdkesivknllhdyafvanhplerswansknfkiy kydpkkaedllvsagfkknkdgnfekdgkilefeiwamsndplrvslagilqsefrkigv vskvvakpagsfdyskvdsfligwgspldpdfhtfrvfessqdsalndegwnfghyhdkk vdialqkarntsnleerkkyykdfidalyenppfiflayldfalvynkdlkgiktrtlgh hgvgftwnvyewsk
Timeline for d4oeta_: