Lineage for d1and__ (1and -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries) 
Domain d1and__: 1and - [25985]
Details for d1and__
PDB Entry: 1and (more details), 2.3 Å
PDB Description: anionic trypsin mutant with arg 96 replaced by his
SCOP Domain Sequences for d1and__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1and__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdhktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
SCOP Domain Coordinates for d1and__:
Click to download the PDB-style file with coordinates for d1and__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1and__:
- d1and__ first appeared (with stable ids) in SCOP 1.55
- d1and__ appears in SCOP 1.59
- d1and__ appears in the current release, SCOPe 2.08, called d1anda_
View in 3D