Lineage for d4nxca_ (4nxc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688165Domain d4nxca_: 4nxc A: [259844]
    automated match to d1ufpa_
    complexed with hem, n2o, so4, zn

Details for d4nxca_

PDB Entry: 4nxc (more details), 1.55 Å

PDB Description: sperm whale myoglobin under 30 bar nitrous oxide
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d4nxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxca_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d4nxca_:

Click to download the PDB-style file with coordinates for d4nxca_.
(The format of our PDB-style files is described here.)

Timeline for d4nxca_: