SCOPe 2.08: Domain d4nxfb_: 4nxf B:

Lineage for d4nxfb_ (4nxf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
   contains PAC motif

6. Protein automated matches [190943] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)

8. Domain d4nxfb_: 4nxf B: [259841]
   automated match to d4eesa_
   complexed with fmn

Details for d4nxfb_

PDB Entry: 4nxf, 1.77 Å

PDB Description: crystal structure of ilov-i486(2lt) at ph 8.0

PDB Compounds: (B:) Phototropin-2

SCOPe Domain Sequences for d4nxfb_:

Sequence; same for both SEQRES and ATOM records:

>d4nxfb_ d.110.3.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdaird
qrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqldg

Timeline for d4nxfb_:

• d4nxfb_ first appeared in SCOPe 2.04
  
• d4nxfb_ appears in SCOPe 2.07