Lineage for d4nxfb_ (4nxf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970499Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2970518Protein automated matches [190943] (2 species)
    not a true protein
  7. 2970525Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)
  8. 2970536Domain d4nxfb_: 4nxf B: [259841]
    automated match to d4eesa_
    complexed with fmn

Details for d4nxfb_

PDB Entry: 4nxf (more details), 1.77 Å

PDB Description: crystal structure of ilov-i486(2lt) at ph 8.0
PDB Compounds: (B:) Phototropin-2

SCOPe Domain Sequences for d4nxfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxfb_ d.110.3.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdaird
qrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqldg

SCOPe Domain Coordinates for d4nxfb_:

Click to download the PDB-style file with coordinates for d4nxfb_.
(The format of our PDB-style files is described here.)

Timeline for d4nxfb_: