SCOPe 2.08: Domain d1anea_: 1ane A:

Lineage for d1anea_ (1ane A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d1anea_: 1ane A: [25984]
   complexed with ben

Details for d1anea_

PDB Entry: 1ane, 2.2 Å

PDB Description: anionic trypsin wild type

PDB Compounds: (A:) anionic trypsin

SCOPe Domain Sequences for d1anea_:

Sequence; same for both SEQRES and ATOM records:

>d1anea_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1anea_:

• d1anea_ first appeared (with stable ids) in SCOP 1.55, called d1ane__
  
• d1anea_ appears in SCOPe 2.07