Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (3 PDB entries) |
Domain d4nnjd_: 4nnj D: [259837] automated match to d3dbhi_ complexed with amp, gol, so4 |
PDB Entry: 4nnj (more details), 2.4 Å
SCOPe Domain Sequences for d4nnjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnjd_ d.15.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} amqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdy niqkestlhlvlrlrgg
Timeline for d4nnjd_: