Lineage for d4nfgb_ (4nfg B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1720034Protein automated matches [190113] (15 species)
    not a true protein
  7. 1720048Species Horse (Equus caballus) [TaxId:9796] [259832] (1 PDB entry)
  8. 1720049Domain d4nfgb_: 4nfg B: [259833]
    Other proteins in same PDB: d4nfga_
    automated match to d3o1ya_
    complexed with hec, hem, unx; mutant

Details for d4nfgb_

PDB Entry: 4nfg (more details), 2.11 Å

PDB Description: K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d4nfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfgb_ a.3.1.1 (B:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
gdvekgkkifvqrcaqchtvekggknktgpnlnglfgrktgqapgftytdanknkgitwk
eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne

SCOPe Domain Coordinates for d4nfgb_:

Click to download the PDB-style file with coordinates for d4nfgb_.
(The format of our PDB-style files is described here.)

Timeline for d4nfgb_: