![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (15 species) not a true protein |
![]() | Species Horse (Equus caballus) [TaxId:9796] [259832] (1 PDB entry) |
![]() | Domain d4nfgb_: 4nfg B: [259833] Other proteins in same PDB: d4nfga_ automated match to d3o1ya_ complexed with hec, hem, unx; mutant |
PDB Entry: 4nfg (more details), 2.11 Å
SCOPe Domain Sequences for d4nfgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nfgb_ a.3.1.1 (B:) automated matches {Horse (Equus caballus) [TaxId: 9796]} gdvekgkkifvqrcaqchtvekggknktgpnlnglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d4nfgb_: