SCOP 1.71: Domain d1brbe_: 1brb E:

Lineage for d1brbe_ (1brb E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1brbe_: 1brb E: [25983]
   Other proteins in same PDB: d1brbi_

Details for d1brbe_

PDB Entry: 1brb, 2.1 Å

PDB Description: crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti

SCOP Domain Sequences for d1brbe_:

Sequence; same for both SEQRES and ATOM records:

>d1brbe_ b.47.1.2 (E:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

Timeline for d1brbe_:

• d1brbe_ first appeared (with stable ids) in SCOP 1.55
  
• d1brbe_ appears in SCOP 1.69
  
• d1brbe_ appears in SCOP 1.73
  
• d1brbe_ appears in the current release, SCOPe 2.08