![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries) |
![]() | Domain d1brbe_: 1brb E: [25983] Other proteins in same PDB: d1brbi_ |
PDB Entry: 1brb (more details), 2.1 Å
SCOPe Domain Sequences for d1brbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brbe_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]} ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan
Timeline for d1brbe_: