Lineage for d4ndna1 (4ndn A:15-115)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926950Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1926951Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1927050Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1927051Protein automated matches [254617] (8 species)
    not a true protein
  7. 1927088Species Human (Homo sapiens) [TaxId:9606] [255522] (2 PDB entries)
  8. 1927092Domain d4ndna1: 4ndn A:15-115 [259828]
    Other proteins in same PDB: d4ndne_, d4ndnf_
    automated match to d2obva1
    complexed with edo, mg, ppk, sam

Details for d4ndna1

PDB Entry: 4ndn (more details), 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ndna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndna1 d.130.1.0 (A:15-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqsp

SCOPe Domain Coordinates for d4ndna1:

Click to download the PDB-style file with coordinates for d4ndna1.
(The format of our PDB-style files is described here.)

Timeline for d4ndna1: