Lineage for d4myea_ (4mye A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042859Species Cymbosema roseum [TaxId:202239] [189292] (2 PDB entries)
  8. 2042864Domain d4myea_: 4mye A: [259825]
    automated match to d3a0ka_
    complexed with ca, mn, na, xmm

Details for d4myea_

PDB Entry: 4mye (more details), 1.65 Å

PDB Description: cymosema roseum seed lectin structure complexed with x-man
PDB Compounds: (A:) Cymbosema roseum mannose-specific lectin

SCOPe Domain Sequences for d4myea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4myea_ b.29.1.1 (A:) automated matches {Cymbosema roseum [TaxId: 202239]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi
adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh
iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan

SCOPe Domain Coordinates for d4myea_:

Click to download the PDB-style file with coordinates for d4myea_.
(The format of our PDB-style files is described here.)

Timeline for d4myea_: