![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human herpesvirus 2 [TaxId:10313] [259821] (1 PDB entry) |
![]() | Domain d4mywa_: 4myw A: [259822] automated match to d1jmaa_ complexed with nag |
PDB Entry: 4myw (more details), 3.19 Å
SCOPe Domain Sequences for d4mywa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mywa_ b.1.1.1 (A:) automated matches {Human herpesvirus 2 [TaxId: 10313]} pvldqltdppgvkrvyhiqpsledpfqppsipitvyyavleracrsvllhapseapqivr gasdearkhtynltiawyrmgdncaipitvmeytecpynkslgvcpirtqprwsyydsfs avsednlgflmhapafetagtylrlvkindwteitqfilehrarasckyalplrippaac ltskayqqgvtvdsigmlprfipenqrtvalyslkiagwhgpkppytstllp
Timeline for d4mywa_: