SCOP 1.69: Domain d1anc__: 1anc -

Lineage for d1anc__ (1anc -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1anc__: 1anc - [25982]

Details for d1anc__

PDB Entry: 1anc, 2.2 Å

PDB Description: anionic trypsin mutant with ser 214 replaced by lys

SCOP Domain Sequences for d1anc__:

Sequence; same for both SEQRES and ATOM records:

>d1anc__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivkwgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1anc__:

• d1anc__ first appeared (with stable ids) in SCOP 1.55
  
• d1anc__ appears in SCOP 1.67
  
• d1anc__ appears in SCOP 1.71
  
• d1anc__ appears in the current release, SCOPe 2.08, called d1anca_