Lineage for d4mx7a1 (4mx7 A:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938915Domain d4mx7a1: 4mx7 A:7-185 [259819]
    Other proteins in same PDB: d4mx7a2, d4mx7b_
    automated match to d3hujc1
    complexed with mx7, nag

Details for d4mx7a1

PDB Entry: 4mx7 (more details), 2.24 Å

PDB Description: structure of mouse cd1d in complex with dioleoyl-phosphatidic acid
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4mx7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mx7a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d4mx7a1:

Click to download the PDB-style file with coordinates for d4mx7a1.
(The format of our PDB-style files is described here.)

Timeline for d4mx7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mx7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4mx7b_