![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (17 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (6 PDB entries) |
![]() | Domain d4mu1a1: 4mu1 A:9-95 [259816] Other proteins in same PDB: d4mu1a2 automated match to d2f1da1 complexed with edo, imd, mn, so4 |
PDB Entry: 4mu1 (more details), 1.5 Å
SCOPe Domain Sequences for d4mu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mu1a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt hiddhhtnedvalaigtallkalgerk
Timeline for d4mu1a1: