SCOPe 2.05: Domain d4mu1a1: 4mu1 A:9-95

Lineage for d4mu1a1 (4mu1 A:9-95)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (6 PDB entries)

8. Domain d4mu1a1: 4mu1 A:9-95 [259816]
   Other proteins in same PDB: d4mu1a2
   automated match to d2f1da1
   complexed with edo, imd, mn, so4

Details for d4mu1a1

PDB Entry: 4mu1, 1.5 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4mu1a1:

Sequence; same for both SEQRES and ATOM records:

>d4mu1a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk

Timeline for d4mu1a1:

• d4mu1a1 first appeared in SCOPe 2.04
  
• d4mu1a1 appears in SCOPe 2.06
  
• d4mu1a1 appears in the current release, SCOPe 2.08