Lineage for d4ms8d2 (4ms8 D:113-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759961Domain d4ms8d2: 4ms8 D:113-241 [259813]
    Other proteins in same PDB: d4ms8a1, d4ms8a2, d4ms8c2
    automated match to d2axhb2

Details for d4ms8d2

PDB Entry: 4ms8 (more details), 1.92 Å

PDB Description: 42f3 tcr pcpb9/h-2ld complex
PDB Compounds: (D:) 42F3 beta

SCOPe Domain Sequences for d4ms8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ms8d2 b.1.1.0 (D:113-241) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d4ms8d2:

Click to download the PDB-style file with coordinates for d4ms8d2.
(The format of our PDB-style files is described here.)

Timeline for d4ms8d2: