SCOPe 2.05: Domain d4ms8d1: 4ms8 D:3-112

Lineage for d4ms8d1 (4ms8 D:3-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4ms8d1: 4ms8 D:3-112 [259812]
   Other proteins in same PDB: d4ms8a_, d4ms8c2
   automated match to d2axhb1

Details for d4ms8d1

PDB Entry: 4ms8, 1.92 Å

PDB Description: 42f3 tcr pcpb9/h-2ld complex

PDB Compounds: (D:) 42F3 beta

SCOPe Domain Sequences for d4ms8d1:

Sequence; same for both SEQRES and ATOM records:

>d4ms8d1 b.1.1.0 (D:3-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqigdvpd
gykatrttqedfflllelaspsqtslyfcassdapgqlyfgegskltvle

Timeline for d4ms8d1:

• d4ms8d1 first appeared in SCOPe 2.04
  
• d4ms8d1 appears in SCOPe 2.06
  
• d4ms8d1 appears in the current release, SCOPe 2.08