SCOPe 2.08: Domain d4mtsa_: 4mts A:

Lineage for d4mtsa_ (4mts A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [259805] (4 PDB entries)

8. Domain d4mtsa_: 4mts A: [259806]
   automated match to d1f9za_
   complexed with gol, ni, zn

Details for d4mtsa_

PDB Entry: 4mts, 1.8 Å

PDB Description: ni- and zn-bound gloa2 at high resolution

PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d4mtsa_:

Sequence; same for both SEQRES and ATOM records:

>d4mtsa_ d.32.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk
veliqkgtq

Timeline for d4mtsa_:

• d4mtsa_ first appeared in SCOPe 2.04
  
• d4mtsa_ appears in SCOPe 2.07