![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein automated matches [190691] (3 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [259803] (1 PDB entry) |
![]() | Domain d2msna1: 2msn A:1-206 [259804] Other proteins in same PDB: d2msna2 automated match to d2go7c_ |
PDB Entry: 2msn (more details)
SCOPe Domain Sequences for d2msna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2msna1 c.108.1.6 (A:1-206) automated matches {Streptococcus pneumoniae [TaxId: 170187]} mqktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaed rnldvevlnqvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdl gvesyfteiltsqsgfvrkpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsi nflestyegnhriqaladisrifetk
Timeline for d2msna1: