Lineage for d2msna1 (2msn A:1-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919696Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919796Protein automated matches [190691] (3 species)
    not a true protein
  7. 2919806Species Streptococcus pneumoniae [TaxId:170187] [259803] (1 PDB entry)
  8. 2919807Domain d2msna1: 2msn A:1-206 [259804]
    Other proteins in same PDB: d2msna2
    automated match to d2go7c_

Details for d2msna1

PDB Entry: 2msn (more details)

PDB Description: nmr structure of a putative phosphoglycolate phosphatase (np_346487.1) from streptococcus pneumoniae tigr4
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d2msna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msna1 c.108.1.6 (A:1-206) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mqktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaed
rnldvevlnqvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdl
gvesyfteiltsqsgfvrkpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsi
nflestyegnhriqaladisrifetk

SCOPe Domain Coordinates for d2msna1:

Click to download the PDB-style file with coordinates for d2msna1.
(The format of our PDB-style files is described here.)

Timeline for d2msna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2msna2