Lineage for d4m9oa_ (4m9o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761679Species Zebrafish (Danio rerio) [TaxId:7955] [259798] (1 PDB entry)
  8. 2761680Domain d4m9oa_: 4m9o A: [259799]
    automated match to d3rgvd_

Details for d4m9oa_

PDB Entry: 4m9o (more details), 2.14 Å

PDB Description: Crystal Structure of monomeric zebrafish beta-2-microglobulin
PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4m9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9oa_ b.1.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kvstpkvhvyshfpgeygkpntlicyvssfhppdisiellkngqvmsdtkqtdlafekgw
qfhltksvaftpekgdeytcsvrhmketkkfswepnm

SCOPe Domain Coordinates for d4m9oa_:

Click to download the PDB-style file with coordinates for d4m9oa_.
(The format of our PDB-style files is described here.)

Timeline for d4m9oa_: