| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [259798] (1 PDB entry) |
| Domain d4m9oa_: 4m9o A: [259799] automated match to d3rgvd_ |
PDB Entry: 4m9o (more details), 2.14 Å
SCOPe Domain Sequences for d4m9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9oa_ b.1.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kvstpkvhvyshfpgeygkpntlicyvssfhppdisiellkngqvmsdtkqtdlafekgw
qfhltksvaftpekgdeytcsvrhmketkkfswepnm
Timeline for d4m9oa_: