SCOPe 2.08: Domain d4lhna1: 4lhn A:25-271

Lineage for d4lhna1 (4lhn A:25-271)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (4 families)

5. Family b.179.1.2: GLEYA domain [254187] (2 proteins)
   Pfam PF10528
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

6. Protein automated matches [254737] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries)

8. Domain d4lhna1: 4lhn A:25-271 [259793]
   Other proteins in same PDB: d4lhna2
   automated match to d2xjra_
   complexed with ca, man

Details for d4lhna1

PDB Entry: 4lhn, 2.12 Å

PDB Description: structure of the n-terminal domain of the flo1 adhesin (n-flo1p) from the yeast saccharomyces cerevisiae, in complex with calcium and mannose

PDB Compounds: (A:) Flocculation protein FLO1

SCOPe Domain Sequences for d4lhna1:

Sequence; same for both SEQRES and ATOM records:

>d4lhna1 b.179.1.2 (A:25-271) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisidyn
ipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtgyf
lppqtgsytfkfatvddsailsvggatafnccaqqqppitstnftidgikpwggslppni
egtvymyagyyypmkvvysnavswgtlpisvtlpdgttvsddfegyvysfdddlsqsnct
vpdpsny

Timeline for d4lhna1:

• d4lhna1 first appeared in SCOPe 2.04, called d4lhna_
  
• d4lhna1 appears in SCOPe 2.07