Lineage for d4kyib_ (4kyi B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1850071Domain d4kyib_: 4kyi B: [259792]
    automated match to d1s8fb_
    complexed with edo, gnp, gol, mg

Details for d4kyib_

PDB Entry: 4kyi (more details), 3.08 Å

PDB Description: crystal structure of the phospholipase vipd from legionella pneumophila in complex with the human gtpase rab5
PDB Compounds: (B:) Ras-related protein Rab-5C

SCOPe Domain Sequences for d4kyib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kyib_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl

SCOPe Domain Coordinates for d4kyib_:

Click to download the PDB-style file with coordinates for d4kyib_.
(The format of our PDB-style files is described here.)

Timeline for d4kyib_: