Lineage for d1slwb_ (1slw B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15497Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (21 PDB entries)
  8. 15502Domain d1slwb_: 1slw B: [25979]
    Other proteins in same PDB: d1slwa_

Details for d1slwb_

PDB Entry: 1slw (more details), 2 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound

SCOP Domain Sequences for d1slwb_:

Sequence, based on SEQRES records: (download)

>d1slwb_ b.47.1.2 (B:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatialpsscapagtqclisg
wghtlssgvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d1slwb_ b.47.1.2 (B:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvkvatialpsscapagtqclisgwght
lnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelq
givswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1slwb_:

Click to download the PDB-style file with coordinates for d1slwb_.
(The format of our PDB-style files is described here.)

Timeline for d1slwb_: