SCOPe 2.04: Domain d4kxzl2: 4kxz L:108-213

Lineage for d4kxzl2 (4kxz L:108-213)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d4kxzl2: 4kxz L:108-213 [259788]
Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzl1, d4kxzp1
automated match to d1dn0a2
complexed with mes, pe5

Details for d4kxzl2

PDB Entry: 4kxz (more details), 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.

PDB Compounds: (L:) GC1008 Light Chain

SCOPe Domain Sequences for d4kxzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxzl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4kxzl2:

Click to download the PDB-style file with coordinates for d4kxzl2.
(The format of our PDB-style files is described here.)

Timeline for d4kxzl2: